Brand: | Abnova |
Reference: | H00001400-M50 |
Product name: | CRMP1 monoclonal antibody (M50), clone 2B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CRMP1. |
Clone: | 2B6 |
Isotype: | IgG2a Kappa |
Gene id: | 1400 |
Gene name: | CRMP1 |
Gene alias: | DPYSL1|DRP-1|DRP1 |
Gene description: | collapsin response mediator protein 1 |
Genbank accession: | NM_001014809 |
Immunogen: | CRMP1 (NP_001014809.1, 221 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL |
Protein accession: | NP_001014809.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CRMP1 monoclonal antibody (M50), clone 2B6. Western Blot analysis of CRMP1 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |