Brand: | Abnova |
Reference: | H00001388-M02 |
Product name: | CREBL1 monoclonal antibody (M02), clone 4D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CREBL1. |
Clone: | 4D10 |
Isotype: | IgG2a Kappa |
Gene id: | 1388 |
Gene name: | ATF6B |
Gene alias: | CREB-RP|CREBL1|FLJ10066|G13 |
Gene description: | activating transcription factor 6 beta |
Genbank accession: | NM_004381 |
Immunogen: | CREBL1 (NP_004372.3, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK |
Protein accession: | NP_004372.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CREBL1 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |