Brand: | Abnova |
Reference: | H00001376-A01 |
Product name: | CPT2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CPT2. |
Gene id: | 1376 |
Gene name: | CPT2 |
Gene alias: | CPT1|CPTASE |
Gene description: | carnitine palmitoyltransferase II |
Genbank accession: | BC005172 |
Immunogen: | CPT2 (AAH05172, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR |
Protein accession: | AAH05172 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CPT2 polyclonal antibody (A01), Lot # TTB0060412QCS1 Western Blot analysis of CPT2 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |