CPT1A monoclonal antibody (M02), clone 1D3 View larger

CPT1A monoclonal antibody (M02), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPT1A monoclonal antibody (M02), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CPT1A monoclonal antibody (M02), clone 1D3

Brand: Abnova
Reference: H00001374-M02
Product name: CPT1A monoclonal antibody (M02), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant CPT1A.
Clone: 1D3
Isotype: IgG2a Kappa
Gene id: 1374
Gene name: CPT1A
Gene alias: CPT1|CPT1-L|L-CPT1
Gene description: carnitine palmitoyltransferase 1A (liver)
Genbank accession: NM_001876
Immunogen: CPT1A (NP_001867.2, 461 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
Protein accession: NP_001867.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001374-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001374-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CPT1A is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CPT1A monoclonal antibody (M02), clone 1D3 now

Add to cart