CPS1 monoclonal antibody (M02), clone 4A10 View larger

CPS1 monoclonal antibody (M02), clone 4A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPS1 monoclonal antibody (M02), clone 4A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CPS1 monoclonal antibody (M02), clone 4A10

Brand: Abnova
Reference: H00001373-M02
Product name: CPS1 monoclonal antibody (M02), clone 4A10
Product description: Mouse monoclonal antibody raised against a partial recombinant CPS1.
Clone: 4A10
Isotype: IgG1 Lambda
Gene id: 1373
Gene name: CPS1
Gene alias: -
Gene description: carbamoyl-phosphate synthetase 1, mitochondrial
Genbank accession: NM_001875
Immunogen: CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Protein accession: NP_001866
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001373-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001373-M02-1-1-1.jpg
Application image note: CPS1 monoclonal antibody (M02), clone 4A10. Western Blot analysis of CPS1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CPS1 monoclonal antibody (M02), clone 4A10 now

Add to cart