Brand: | Abnova |
Reference: | H00001373-M02 |
Product name: | CPS1 monoclonal antibody (M02), clone 4A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPS1. |
Clone: | 4A10 |
Isotype: | IgG1 Lambda |
Gene id: | 1373 |
Gene name: | CPS1 |
Gene alias: | - |
Gene description: | carbamoyl-phosphate synthetase 1, mitochondrial |
Genbank accession: | NM_001875 |
Immunogen: | CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA |
Protein accession: | NP_001866 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CPS1 monoclonal antibody (M02), clone 4A10. Western Blot analysis of CPS1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |