CLDN7 (Human) Recombinant Protein (P01) View larger

CLDN7 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLDN7 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CLDN7 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00001366-P01
Product name: CLDN7 (Human) Recombinant Protein (P01)
Product description: Human CLDN7 full-length ORF ( NP_001298.2, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 1366
Gene name: CLDN7
Gene alias: CEPTRL2|CPETRL2|Hs.84359|claudin-1
Gene description: claudin 7
Genbank accession: NM_001307.3
Immunogen sequence/protein sequence: MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV
Protein accession: NP_001298.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00001366-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Trypsin-2 Enhances Carcinoma Invasion by Processing Tight Junctions and Activating ProMT1-MMP.Vilen ST, Suojanen J, Salas F, Risteli J, Ylipalosaari M, Itkonen O, Koistinen H, Baumann M, Stenman UH, Sorsa T, Salo T, Nyberg P.
Cancer Invest. 2012 Aug 21.

Reviews

Buy CLDN7 (Human) Recombinant Protein (P01) now

Add to cart