Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CPA3 monoclonal antibody (M14), clone 2D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about CPA3 monoclonal antibody (M14), clone 2D1
| Brand: | Abnova |
| Reference: | H00001359-M14 |
| Product name: | CPA3 monoclonal antibody (M14), clone 2D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CPA3. |
| Clone: | 2D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1359 |
| Gene name: | CPA3 |
| Gene alias: | - |
| Gene description: | carboxypeptidase A3 (mast cell) |
| Genbank accession: | NM_001870 |
| Immunogen: | CPA3 (NP_001861, 318 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS |
| Protein accession: | NP_001861 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CPA3 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |