COX15 monoclonal antibody (M01), clone 2D2 View larger

COX15 monoclonal antibody (M01), clone 2D2

H00001355-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COX15 monoclonal antibody (M01), clone 2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about COX15 monoclonal antibody (M01), clone 2D2

Brand: Abnova
Reference: H00001355-M01
Product name: COX15 monoclonal antibody (M01), clone 2D2
Product description: Mouse monoclonal antibody raised against a partial recombinant COX15.
Clone: 2D2
Isotype: IgG2a Kappa
Gene id: 1355
Gene name: COX15
Gene alias: -
Gene description: COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Genbank accession: NM_078470
Immunogen: COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
Protein accession: NP_510870
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001355-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001355-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy COX15 monoclonal antibody (M01), clone 2D2 now

Add to cart