COX6B1 monoclonal antibody (M01), clone 5D3 View larger

COX6B1 monoclonal antibody (M01), clone 5D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COX6B1 monoclonal antibody (M01), clone 5D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,ELISA,WB-Re

More info about COX6B1 monoclonal antibody (M01), clone 5D3

Brand: Abnova
Reference: H00001340-M01
Product name: COX6B1 monoclonal antibody (M01), clone 5D3
Product description: Mouse monoclonal antibody raised against a partial recombinant COX6B1.
Clone: 5D3
Isotype: IgG1 Kappa
Gene id: 1340
Gene name: COX6B1
Gene alias: COX6B|COXG
Gene description: cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
Genbank accession: NM_001863
Immunogen: COX6B1 (NP_001854, 1 a.a. ~ 86 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Protein accession: NP_001854
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001340-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001340-M01-1-2-1.jpg
Application image note: COX6B1 monoclonal antibody (M01), clone 5D3 Western Blot analysis of COX6B1 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COX6B1 monoclonal antibody (M01), clone 5D3 now

Add to cart