Brand: | Abnova |
Reference: | H00001329-M03 |
Product name: | COX5B monoclonal antibody (M03), clone 1E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COX5B. |
Clone: | 1E8 |
Isotype: | IgG1 Kappa |
Gene id: | 1329 |
Gene name: | COX5B |
Gene alias: | COXVB |
Gene description: | cytochrome c oxidase subunit Vb |
Genbank accession: | NM_001862 |
Immunogen: | COX5B (NP_001853, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLA |
Protein accession: | NP_001853 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00001329-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00001329-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00001329-M03-1-12-1.jpg](http://www.abnova.com/application_image/H00001329-M03-1-12-1.jpg) |
Application image note: | COX5B monoclonal antibody (M03), clone 1E8 Western Blot analysis of COX5B expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |