Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KLF6 monoclonal antibody (M01), clone 1A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about KLF6 monoclonal antibody (M01), clone 1A9
| Brand: | Abnova |
| Reference: | H00001316-M01 |
| Product name: | KLF6 monoclonal antibody (M01), clone 1A9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant KLF6. |
| Clone: | 1A9 |
| Isotype: | IgG1 kappa |
| Gene id: | 1316 |
| Gene name: | KLF6 |
| Gene alias: | BCD1|COPEB|CPBP|DKFZp686N0199|GBF|PAC1|ST12|ZF9 |
| Gene description: | Kruppel-like factor 6 |
| Genbank accession: | BC004301.1 |
| Immunogen: | KLF6 (AAH04301.1, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPF |
| Protein accession: | AAH04301.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of KLF6 expression in transfected 293T cell line by KLF6 monoclonal antibody (M01), clone 1A9. Lane 1: KLF6 transfected lysate(28.71 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Caffeic Acid Phenethyl Ester Causes p21 Induction, Akt Signaling Reduction, and Growth Inhibition in PC-3 Human Prostate Cancer Cells.Lin HP, Jiang SS, Chuu CP. PLoS One. 2012;7(2):e31286. Epub 2012 Feb 7. |