Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of COL11A2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about COL11A2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001302-A01 |
| Product name: | COL11A2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant COL11A2. |
| Gene id: | 1302 |
| Gene name: | COL11A2 |
| Gene alias: | DFNA13|DFNB53|HKE5|PARP|STL3 |
| Gene description: | collagen, type XI, alpha 2 |
| Genbank accession: | NM_080680 |
| Immunogen: | COL11A2 (NP_542411, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | APPVDVLRALRFPSLPDGVRRAKGICPADVAYRVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPVRFLYEDQT |
| Protein accession: | NP_542411 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Novel tissue-derived biomimetic scaffold for regenerating the human nucleus pulposus.Mercuri JJ, Gill SS, Simionescu DT. J Biomed Mater Res A. 2011 Feb;96(2):422-35. doi: 10.1002/jbm.a.33001. Epub 2010 Dec 8. |