COL9A1 polyclonal antibody (A01) View larger

COL9A1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COL9A1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about COL9A1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001297-A01
Product name: COL9A1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant COL9A1.
Gene id: 1297
Gene name: COL9A1
Gene alias: DJ149L1.1.2|EDM6|FLJ40263|MED
Gene description: collagen, type IX, alpha 1
Genbank accession: NM_001851
Immunogen: COL9A1 (NP_001842, 24 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQ
Protein accession: NP_001842
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001297-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COL9A1 polyclonal antibody (A01) now

Add to cart