Brand: | Abnova |
Reference: | H00001278-M03 |
Product name: | COL1A2 monoclonal antibody (M03), clone 7E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COL1A2. |
Clone: | 7E11 |
Isotype: | IgG2a Kappa |
Gene id: | 1278 |
Gene name: | COL1A2 |
Gene alias: | OI4 |
Gene description: | collagen, type I, alpha 2 |
Genbank accession: | BC054498 |
Immunogen: | COL1A2 (AAH54498.1, 1257 a.a. ~ 1366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK |
Protein accession: | AAH54498.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |