Brand: | Abnova |
Reference: | H00001268-M02 |
Product name: | CNR1 monoclonal antibody (M02), clone 1F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CNR1. |
Clone: | 1F9 |
Isotype: | IgG2a Kappa |
Gene id: | 1268 |
Gene name: | CNR1 |
Gene alias: | CANN6|CB-R|CB1|CB1A|CB1K5|CB1R|CNR |
Gene description: | cannabinoid receptor 1 (brain) |
Genbank accession: | NM_016083 |
Immunogen: | CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV |
Protein accession: | NP_057167 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CNR1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |