Brand: | Abnova |
Reference: | H00001244-M02 |
Product name: | ABCC2 monoclonal antibody (M02), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCC2. |
Clone: | 2H6 |
Isotype: | IgG1 Kappa |
Gene id: | 1244 |
Gene name: | ABCC2 |
Gene alias: | ABC30|CMOAT|DJS|KIAA1010|MRP2|cMRP |
Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 2 |
Genbank accession: | NM_000392 |
Immunogen: | ABCC2 (NP_000383, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA |
Protein accession: | NP_000383 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ABCC2 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |