Brand: | Abnova |
Reference: | H00001231-M01 |
Product name: | CCR2 monoclonal antibody (M01), clone 4D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCR2. |
Clone: | 4D12 |
Isotype: | IgM Kappa |
Gene id: | 1231 |
Gene name: | CCR2 |
Gene alias: | CC-CKR-2|CCR2A|CCR2B|CD192|CKR2|CKR2A|CKR2B|CMKBR2|MCP-1-R |
Gene description: | chemokine (C-C motif) receptor 2 |
Genbank accession: | NM_000648 |
Immunogen: | CCR2 (NP_000639, 1 a.a. ~ 42 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
Protein accession: | NP_000639 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (30.36 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CCR2 monoclonal antibody (M01), clone 4D12 Western Blot analysis of CCR2 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |