Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCR2 monoclonal antibody (M01), clone 4D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CCR2 monoclonal antibody (M01), clone 4D12
| Brand: | Abnova |
| Reference: | H00001231-M01 |
| Product name: | CCR2 monoclonal antibody (M01), clone 4D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCR2. |
| Clone: | 4D12 |
| Isotype: | IgM Kappa |
| Gene id: | 1231 |
| Gene name: | CCR2 |
| Gene alias: | CC-CKR-2|CCR2A|CCR2B|CD192|CKR2|CKR2A|CKR2B|CMKBR2|MCP-1-R |
| Gene description: | chemokine (C-C motif) receptor 2 |
| Genbank accession: | NM_000648 |
| Immunogen: | CCR2 (NP_000639, 1 a.a. ~ 42 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Protein accession: | NP_000639 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CCR2 monoclonal antibody (M01), clone 4D12 Western Blot analysis of CCR2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |