CLTC polyclonal antibody (A01) View larger

CLTC polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLTC polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CLTC polyclonal antibody (A01)

Brand: Abnova
Reference: H00001213-A01
Product name: CLTC polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CLTC.
Gene id: 1213
Gene name: CLTC
Gene alias: CHC|CHC17|CLH-17|CLTCL2|Hc|KIAA0034
Gene description: clathrin, heavy chain (Hc)
Genbank accession: NM_004859
Immunogen: CLTC (NP_004850, 232 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Protein accession: NP_004850
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001213-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001213-A01-1-22-1.jpg
Application image note: CLTC polyclonal antibody (A01), Lot # O51130JC01 Western Blot analysis of CLTC expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLTC polyclonal antibody (A01) now

Add to cart