Brand: | Abnova |
Reference: | H00001212-M01A |
Product name: | CLTB monoclonal antibody (M01A), clone S1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CLTB. |
Clone: | S1 |
Isotype: | IgG2b Kappa |
Gene id: | 1212 |
Gene name: | CLTB |
Gene alias: | LCB |
Gene description: | clathrin, light chain (Lcb) |
Genbank accession: | BC006457 |
Immunogen: | CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR |
Protein accession: | AAH06457 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (48.95 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CLTB monoclonal antibody (M01A), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |