CLTA monoclonal antibody (M12), clone 4D5 View larger

CLTA monoclonal antibody (M12), clone 4D5

H00001211-M12_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLTA monoclonal antibody (M12), clone 4D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about CLTA monoclonal antibody (M12), clone 4D5

Brand: Abnova
Reference: H00001211-M12
Product name: CLTA monoclonal antibody (M12), clone 4D5
Product description: Mouse monoclonal antibody raised against a full-length recombinant CLTA.
Clone: 4D5
Isotype: IgG2a Kappa
Gene id: 1211
Gene name: CLTA
Gene alias: LCA
Gene description: clathrin, light chain (Lca)
Genbank accession: BC019287.1
Immunogen: CLTA (AAH19287, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Protein accession: AAH19287
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001211-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001211-M12-13-15-1.jpg
Application image note: Western Blot analysis of CLTA expression in transfected 293T cell line by CLTA monoclonal antibody (M12), clone 4D5.

Lane 1: CLTA transfected lysate(23.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLTA monoclonal antibody (M12), clone 4D5 now

Add to cart