Brand: | Abnova |
Reference: | H00001211-M08 |
Product name: | CLTA monoclonal antibody (M08), clone 4E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CLTA. |
Clone: | 4E9 |
Isotype: | IgG2a Kappa |
Gene id: | 1211 |
Gene name: | CLTA |
Gene alias: | LCA |
Gene description: | clathrin, light chain (Lca) |
Genbank accession: | NM_001833 |
Immunogen: | CLTA (NP_001824.1, 118 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS |
Protein accession: | NP_001824.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CLTA monoclonal antibody (M08), clone 4E9. Western Blot analysis of CLTA expression in human kidney. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |