Brand: | Abnova |
Reference: | H00001198-A01 |
Product name: | CLK3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CLK3. |
Gene id: | 1198 |
Gene name: | CLK3 |
Gene alias: | FLJ22858|PHCLK3|PHCLK3/152 |
Gene description: | CDC-like kinase 3 |
Genbank accession: | BC002555 |
Immunogen: | CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV |
Protein accession: | AAH02555 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |