Brand: | Abnova |
Reference: | H00001192-M02 |
Product name: | CLIC1 monoclonal antibody (M02), clone 3F9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CLIC1. |
Clone: | 3F9 |
Isotype: | IgG2a Kappa |
Gene id: | 1192 |
Gene name: | CLIC1 |
Gene alias: | G6|NCC27 |
Gene description: | chloride intracellular channel 1 |
Genbank accession: | BC064527 |
Immunogen: | CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
Protein accession: | AAH64527.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (52.25 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CLIC1 monoclonal antibody (M02), clone 3F9 Western Blot analysis of CLIC1 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle.Chaze T, Meunier B, Chambon C, Jurie C, Picard B. Animal (2009) doi:10.1017 /S1751731 109004315 |