Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CLIC1 monoclonal antibody (M01), clone 2D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about CLIC1 monoclonal antibody (M01), clone 2D4
| Brand: | Abnova |
| Reference: | H00001192-M01 |
| Product name: | CLIC1 monoclonal antibody (M01), clone 2D4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CLIC1. |
| Clone: | 2D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1192 |
| Gene name: | CLIC1 |
| Gene alias: | G6|NCC27 |
| Gene description: | chloride intracellular channel 1 |
| Genbank accession: | BC064527 |
| Immunogen: | CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
| Protein accession: | AAH64527.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.25 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Redox proteomics reveal stress responsive proteins linking peroxiredoxin-1 status in glioma to chemosensitivity and oxidative stress.Poschmann G, Grzendowski M, Stefanski A, Bruns E, Meyer HE, Stuhler K Biochim Biophys Acta. 2014 Dec 4. pii: S1570-9639(14)00316-1. doi: 10.1016/j.bbapap.2014.11.011. |