CLU monoclonal antibody (M01), clone 1A11 View larger

CLU monoclonal antibody (M01), clone 1A11

H00001191-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLU monoclonal antibody (M01), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CLU monoclonal antibody (M01), clone 1A11

Brand: Abnova
Reference: H00001191-M01
Product name: CLU monoclonal antibody (M01), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant CLU.
Clone: 1A11
Isotype: IgG1 Kappa
Gene id: 1191
Gene name: CLU
Gene alias: AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene description: clusterin
Genbank accession: NM_001831
Immunogen: CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Protein accession: NP_001822.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001191-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001191-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CLU is approximately 0.1ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLU monoclonal antibody (M01), clone 1A11 now

Add to cart