CLCA1 monoclonal antibody (M03), clone 2C10 View larger

CLCA1 monoclonal antibody (M03), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLCA1 monoclonal antibody (M03), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CLCA1 monoclonal antibody (M03), clone 2C10

Brand: Abnova
Reference: H00001179-M03
Product name: CLCA1 monoclonal antibody (M03), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant CLCA1.
Clone: 2C10
Isotype: IgG1 Kappa
Gene id: 1179
Gene name: CLCA1
Gene alias: CACC|CACC1|CLCRG1|FLJ95147|GOB5
Gene description: chloride channel regulator 1
Genbank accession: NM_001285
Immunogen: CLCA1 (NP_001276, 677 a.a. ~ 776 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP
Protein accession: NP_001276
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001179-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001179-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CLCA1 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLCA1 monoclonal antibody (M03), clone 2C10 now

Add to cart