AP2S1 polyclonal antibody (A01) View larger

AP2S1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP2S1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about AP2S1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001175-A01
Product name: AP2S1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant AP2S1.
Gene id: 1175
Gene name: AP2S1
Gene alias: AP17|AP17-DELTA|CLAPS2
Gene description: adaptor-related protein complex 2, sigma 1 subunit
Genbank accession: BC006337
Immunogen: AP2S1 (AAH06337, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Protein accession: AAH06337
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001175-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AP2S1 polyclonal antibody (A01) now

Add to cart