Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00001174-B02P |
Product name: | AP1S1 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human AP1S1 protein. |
Gene id: | 1174 |
Gene name: | AP1S1 |
Gene alias: | AP19|CLAPS1|FLJ92436|SIGMA1A|WUGSC:H_DJ0747G18.2 |
Gene description: | adaptor-related protein complex 1, sigma 1 subunit |
Genbank accession: | NM_001283 |
Immunogen: | AP1S1 (NP_001274.1, 1 a.a. ~ 158 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA |
Protein accession: | NP_001274.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of AP1S1 expression in transfected 293T cell line (H00001174-T03) by AP1S1 MaxPab polyclonal antibody. Lane 1: AP1S1 transfected lysate(18.70 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |