Brand: | Abnova |
Reference: | H00001174-A01 |
Product name: | AP1S1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant AP1S1. |
Gene id: | 1174 |
Gene name: | AP1S1 |
Gene alias: | AP19|CLAPS1|FLJ92436|SIGMA1A|WUGSC:H_DJ0747G18.2 |
Gene description: | adaptor-related protein complex 1, sigma 1 subunit |
Genbank accession: | BC003561 |
Immunogen: | AP1S1 (AAH03561, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH |
Protein accession: | AAH03561 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |