TBCB purified MaxPab mouse polyclonal antibody (B01P) View larger

TBCB purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBCB purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about TBCB purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001155-B01P
Product name: TBCB purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TBCB protein.
Gene id: 1155
Gene name: TBCB
Gene alias: CG22|CKAP1|CKAPI|MGC14625
Gene description: tubulin folding cofactor B
Genbank accession: BC005969
Immunogen: TBCB (AAH05969, 1 a.a. ~ 244 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Protein accession: AAH05969
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001155-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TBCB expression in transfected 293T cell line (H00001155-T01) by TBCB MaxPab polyclonal antibody.

Lane 1: CKAP1 transfected lysate(26.84 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TBCB purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart