Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00001155-B01 |
Product name: | TBCB MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human TBCB protein. |
Gene id: | 1155 |
Gene name: | TBCB |
Gene alias: | CG22|CKAP1|CKAPI|MGC14625 |
Gene description: | tubulin folding cofactor B |
Genbank accession: | BC005969 |
Immunogen: | TBCB (AAH05969, 1 a.a. ~ 244 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI |
Protein accession: | AAH05969 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TBCB expression in transfected 293T cell line (H00001155-T01) by TBCB MaxPab polyclonal antibody. Lane 1: CKAP1 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |