CIRBP purified MaxPab rabbit polyclonal antibody (D01P) View larger

CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00001153-D01P
Product name: CIRBP purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CIRBP protein.
Gene id: 1153
Gene name: CIRBP
Gene alias: CIRP
Gene description: cold inducible RNA binding protein
Genbank accession: NM_001280.1
Immunogen: CIRBP (NP_001271.1, 1 a.a. ~ 172 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Protein accession: NP_001271.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001153-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CIRBP expression in transfected 293T cell line (H00001153-T02) by CIRBP MaxPab polyclonal antibody.

Lane 1: CIRBP transfected lysate(18.60 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CIRBP purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart