Brand: | Abnova |
Reference: | H00001152-A01 |
Product name: | CKB polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CKB. |
Gene id: | 1152 |
Gene name: | CKB |
Gene alias: | B-CK|CKBB |
Gene description: | creatine kinase, brain |
Genbank accession: | BC001190 |
Immunogen: | CKB (AAH01190, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
Protein accession: | AAH01190 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (68.02 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein.Hara H, Aizaki H, Matsuda M, Shinkai-Ouchi F, Inoue Y, Murakami K, Shoji I, Kawakami H, Matsuura Y, Lai MM, Miyamura T, Wakita T, Suzuki T. J Virol. 2009 May;83(10):5137-47. Epub 2009 Mar 4. |