Brand: | Abnova |
Reference: | H00001129-A01 |
Product name: | CHRM2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CHRM2. |
Gene id: | 1129 |
Gene name: | CHRM2 |
Gene alias: | FLJ43243|HM2|MGC120006|MGC120007 |
Gene description: | cholinergic receptor, muscarinic 2 |
Genbank accession: | NM_000739 |
Immunogen: | CHRM2 (AAI06743.1, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS |
Protein accession: | AAI06743.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CHRM2 polyclonal antibody (A01), Lot # O50912JC01 Western Blot analysis of CHRM2 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |