Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHD4 monoclonal antibody (M01), clone 4H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CHD4 monoclonal antibody (M01), clone 4H4
| Brand: | Abnova |
| Reference: | H00001108-M01 |
| Product name: | CHD4 monoclonal antibody (M01), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHD4. |
| Clone: | 4H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1108 |
| Gene name: | CHD4 |
| Gene alias: | DKFZp686E06161|Mi-2b|Mi2-BETA |
| Gene description: | chromodomain helicase DNA binding protein 4 |
| Genbank accession: | NM_001273 |
| Immunogen: | CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH |
| Protein accession: | NP_001264 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Physical and Functional Interactions between the Histone H3K4 Demethylase KDM5A and the Nucleosome Remodeling and Deacetylase (NuRD) Complex.Nishibuchi G, Shibata Y, Hayakawa T, Hayakawa N, Ohtani Y, Shinmyozu K, Tagami H, Nakayama JI J Biol Chem. 2014 Sep 4. pii: jbc.M114.573725. |