CHD4 polyclonal antibody (A01) View larger

CHD4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHD4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHD4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001108-A01
Product name: CHD4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHD4.
Gene id: 1108
Gene name: CHD4
Gene alias: DKFZp686E06161|Mi-2b|Mi2-BETA
Gene description: chromodomain helicase DNA binding protein 4
Genbank accession: NM_001273
Immunogen: CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Protein accession: NP_001264
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001108-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHD4 polyclonal antibody (A01) now

Add to cart