CHD1 monoclonal antibody (M04), clone 1G2 View larger

CHD1 monoclonal antibody (M04), clone 1G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHD1 monoclonal antibody (M04), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CHD1 monoclonal antibody (M04), clone 1G2

Brand: Abnova
Reference: H00001105-M04
Product name: CHD1 monoclonal antibody (M04), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant CHD1.
Clone: 1G2
Isotype: IgG2b Kappa
Gene id: 1105
Gene name: CHD1
Gene alias: DKFZp686E2337
Gene description: chromodomain helicase DNA binding protein 1
Genbank accession: NM_001270
Immunogen: CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Protein accession: NP_001261
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001105-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001105-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CHD1 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHD1 monoclonal antibody (M04), clone 1G2 now

Add to cart