Brand: | Abnova |
Reference: | H00001105-M04 |
Product name: | CHD1 monoclonal antibody (M04), clone 1G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHD1. |
Clone: | 1G2 |
Isotype: | IgG2b Kappa |
Gene id: | 1105 |
Gene name: | CHD1 |
Gene alias: | DKFZp686E2337 |
Gene description: | chromodomain helicase DNA binding protein 1 |
Genbank accession: | NM_001270 |
Immunogen: | CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS |
Protein accession: | NP_001261 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CHD1 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |