CHD1 polyclonal antibody (A01) View larger

CHD1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHD1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHD1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001105-A01
Product name: CHD1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHD1.
Gene id: 1105
Gene name: CHD1
Gene alias: DKFZp686E2337
Gene description: chromodomain helicase DNA binding protein 1
Genbank accession: NM_001270
Immunogen: CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Protein accession: NP_001261
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001105-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Chromatin Reassembly Factors Are Involved in Transcriptional Interference Promoting HIV Latency.Gallastegui E, Millan-Zambrano G, Terme JM, Chavez S, Jordan A.
J Virol. 2011 Apr;85(7):3187-202. Epub 2011 Jan 26.

Reviews

Buy CHD1 polyclonal antibody (A01) now

Add to cart