Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IF,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00001104-D01 |
Product name: | RCC1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RCC1 protein. |
Gene id: | 1104 |
Gene name: | RCC1 |
Gene alias: | CHC1|RCC1-I |
Gene description: | regulator of chromosome condensation 1 |
Genbank accession: | NM_001269 |
Immunogen: | RCC1 (NP_001260.1, 1 a.a. ~ 421 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS |
Protein accession: | NP_001260.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RCC1 expression in transfected 293T cell line (H00001104-T01) by RCC1 MaxPab polyclonal antibody. Lane 1: RCC1 transfected lysate(45 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr,IP |
Shipping condition: | Dry Ice |