RCC1 MaxPab mouse polyclonal antibody (B01) View larger

RCC1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RCC1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about RCC1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001104-B01
Product name: RCC1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RCC1 protein.
Gene id: 1104
Gene name: RCC1
Gene alias: CHC1|RCC1-I
Gene description: regulator of chromosome condensation 1
Genbank accession: NM_001269
Immunogen: RCC1 (NP_001260, 1 a.a. ~ 421 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Protein accession: NP_001260
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001104-B01-13-15-1.jpg
Application image note: Western Blot analysis of RCC1 expression in transfected 293T cell line (H00001104-T01) by RCC1 MaxPab polyclonal antibody.

Lane 1: RCC1 transfected lysate(46.31 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RCC1 MaxPab mouse polyclonal antibody (B01) now

Add to cart