CFL1 (Human) Recombinant Protein (P01) View larger

CFL1 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CFL1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CFL1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00001072-P01
Product name: CFL1 (Human) Recombinant Protein (P01)
Product description: Human CFL1 full-length ORF ( AAH11005, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 1072
Gene name: CFL1
Gene alias: CFL
Gene description: cofilin 1 (non-muscle)
Genbank accession: BC011005
Immunogen sequence/protein sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Protein accession: AAH11005
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00001072-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Detection of urine cofilin-1 from patients hospitalized in the intensive care unit using the metal-enhanced fluorescence technique.Chao CH, Chang YF, Chen HC, Lin LY, Yu PC, Chang YS, Lee YJ.
Sensors and Actuators B: Chemical (2010), doi:10.1016/ j.snb.2012.06.076

Reviews

Buy CFL1 (Human) Recombinant Protein (P01) now

Add to cart