Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CETN3 monoclonal antibody (M01), clone 3E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about CETN3 monoclonal antibody (M01), clone 3E6
| Brand: | Abnova |
| Reference: | H00001070-M01 |
| Product name: | CETN3 monoclonal antibody (M01), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CETN3. |
| Clone: | 3E6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1070 |
| Gene name: | CETN3 |
| Gene alias: | CEN3|MGC12502|MGC138245 |
| Gene description: | centrin, EF-hand protein, 3 (CDC31 homolog, yeast) |
| Genbank accession: | BC005383 |
| Immunogen: | CETN3 (AAH05383, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH |
| Protein accession: | AAH05383 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CETN3 monoclonal antibody (M01), clone 3E6 Western Blot analysis of CETN3 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Opposing effects of pericentrin and microcephalin on the pericentriolar material regulate CHK1 activation in the DNA damage response.Antonczak AK, Mullee LI, Wang Y, Comartin D, Inoue T, Pelletier L, Morrison CG. Oncogene. 2015 Jul 13. [Epub ahead of print] |