CEBPG purified MaxPab mouse polyclonal antibody (B01P) View larger

CEBPG purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEBPG purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CEBPG purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001054-B01P
Product name: CEBPG purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CEBPG protein.
Gene id: 1054
Gene name: CEBPG
Gene alias: GPE1BP|IG/EBP-1
Gene description: CCAAT/enhancer binding protein (C/EBP), gamma
Genbank accession: NM_001806.2
Immunogen: CEBPG (NP_001797.1, 1 a.a. ~ 150 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Protein accession: NP_001797.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001054-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CEBPG expression in transfected 293T cell line (H00001054-T01) by CEBPG MaxPab polyclonal antibody.

Lane 1: CEBPG transfected lysate(16.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CEBPG purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart