Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CEBPG polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CEBPG polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001054-A01 |
| Product name: | CEBPG polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant CEBPG. |
| Gene id: | 1054 |
| Gene name: | CEBPG |
| Gene alias: | GPE1BP|IG/EBP-1 |
| Gene description: | CCAAT/enhancer binding protein (C/EBP), gamma |
| Genbank accession: | BC013128 |
| Immunogen: | CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ |
| Protein accession: | AAH13128 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG polyclonal antibody (A01). Lane1:CEBPG transfected lysate(16 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |