CLGN monoclonal antibody (M01), clone 3B5 View larger

CLGN monoclonal antibody (M01), clone 3B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLGN monoclonal antibody (M01), clone 3B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CLGN monoclonal antibody (M01), clone 3B5

Brand: Abnova
Reference: H00001047-M01
Product name: CLGN monoclonal antibody (M01), clone 3B5
Product description: Mouse monoclonal antibody raised against a partial recombinant CLGN.
Clone: 3B5
Isotype: IgG2a Kappa
Gene id: 1047
Gene name: CLGN
Gene alias: -
Gene description: calmegin
Genbank accession: NM_004362
Immunogen: CLGN (NP_004353.1, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
Protein accession: NP_004353.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001047-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001047-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CLGN is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CLGN monoclonal antibody (M01), clone 3B5 now

Add to cart