CDX4 monoclonal antibody (M15), clone 3F11 View larger

CDX4 monoclonal antibody (M15), clone 3F11

H00001046-M15_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDX4 monoclonal antibody (M15), clone 3F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CDX4 monoclonal antibody (M15), clone 3F11

Brand: Abnova
Reference: H00001046-M15
Product name: CDX4 monoclonal antibody (M15), clone 3F11
Product description: Mouse monoclonal antibody raised against a full length recombinant CDX4.
Clone: 3F11
Isotype: IgG2a Kappa
Gene id: 1046
Gene name: CDX4
Gene alias: -
Gene description: caudal type homeobox 4
Genbank accession: NM_005193
Immunogen: CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
Protein accession: NP_005184
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001046-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDX4 monoclonal antibody (M15), clone 3F11 now

Add to cart