CDX4 monoclonal antibody (M08), clone 2F8 View larger

CDX4 monoclonal antibody (M08), clone 2F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDX4 monoclonal antibody (M08), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CDX4 monoclonal antibody (M08), clone 2F8

Brand: Abnova
Reference: H00001046-M08
Product name: CDX4 monoclonal antibody (M08), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant CDX4.
Clone: 2F8
Isotype: IgG2a Kappa
Gene id: 1046
Gene name: CDX4
Gene alias: -
Gene description: caudal type homeobox 4
Genbank accession: NM_005193.1
Immunogen: CDX4 (NP_005184.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
Protein accession: NP_005184.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001046-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001046-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CDX4 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDX4 monoclonal antibody (M08), clone 2F8 now

Add to cart