Brand: | Abnova |
Reference: | H00001045-M01A |
Product name: | CDX2 monoclonal antibody (M01A), clone 1C7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CDX2. |
Clone: | 1C7 |
Isotype: | IgG Mix Kappa |
Gene id: | 1045 |
Gene name: | CDX2 |
Gene alias: | CDX-3|CDX3 |
Gene description: | caudal type homeobox 2 |
Genbank accession: | BC014461 |
Immunogen: | CDX2 (AAH14461.1, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
Protein accession: | AAH14461.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (60.17 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDX2 monoclonal antibody (M01A), clone 1C7 Western Blot analysis of CDX2 expression in COLO 320 HSR ( Cat # L020V1 ). |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |