CDX1 monoclonal antibody (M01), clone 2D8 View larger

CDX1 monoclonal antibody (M01), clone 2D8

H00001044-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDX1 monoclonal antibody (M01), clone 2D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,ELISA,WB-Re

More info about CDX1 monoclonal antibody (M01), clone 2D8

Brand: Abnova
Reference: H00001044-M01
Product name: CDX1 monoclonal antibody (M01), clone 2D8
Product description: Mouse monoclonal antibody raised against a partial recombinant CDX1.
Clone: 2D8
Isotype: IgG2a Kappa
Gene id: 1044
Gene name: CDX1
Gene alias: MGC116915
Gene description: caudal type homeobox 1
Genbank accession: NM_001804
Immunogen: CDX1 (NP_001795, 126 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
Protein accession: NP_001795
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001044-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001044-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to CDX1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: WB-Ti,IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Activation of the BMP4 Pathway and Early Expression of CDX2 Characterize Non-specialized Columnar Metaplasia in a Human Model of Barrett's Esophagus.Castillo D, Puig S, Iglesias M, Seoane A, de Bolos C, Munitiz V, Parrilla P, Comerma L, Poulsom R, Krishnadath KK, Grande L, Pera M.
J Gastrointest Surg. 2011 Nov 11.

Reviews

Buy CDX1 monoclonal antibody (M01), clone 2D8 now

Add to cart