H00001032-B01P_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00001032-B01P |
Product name: | CDKN2D purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CDKN2D protein. |
Gene id: | 1032 |
Gene name: | CDKN2D |
Gene alias: | INK4D|p19|p19-INK4D |
Gene description: | cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) |
Genbank accession: | BC001822 |
Immunogen: | CDKN2D (AAH01822, 1 a.a. ~ 166 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL |
Protein accession: | AAH01822 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CDKN2D expression in transfected 293T cell line (H00001032-T01) by CDKN2D MaxPab polyclonal antibody. Lane1:CDKN2D transfected lysate(18.37 KDa). Lane 2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |